Web Analysis for Onepaesthetic - onepaesthetic.com

2.45 Rating by CuteStat

onepaesthetic.com is 1 decade 6 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, onepaesthetic.com is SAFE to browse.

PageSpeed Score
47
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948
Page Title of onepaesthetic.com
Onep Aesthetic | Bir başka WordPress sitesi

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 12 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.
- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri
- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /
- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri
- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /
- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 14 Jul 2017 21:24:41 GMT
Server: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.45
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://onepaesthetic.com/xmlrpc.php
Link: <http://onepaesthetic.com/>; rel=shortlink
Content-Length: 38799
Connection: close
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Lucky Elephant Domains, LLC
Registration Date: Apr 1, 2008, 12:00 AM 1 decade 6 years 2 months ago
Last Modified: May 7, 2015, 12:00 AM 9 years 1 month 3 days ago
Expiration Date: Apr 1, 2018, 12:00 AM 6 years 2 months 2 weeks ago
Domain Status:
ok

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
onepaesthetic.com A 14399 IP: 77.92.140.32
onepaesthetic.com NS 86399 Target: ns1.kotuhost.com
onepaesthetic.com NS 86399 Target: ns2.kotuhost.com
onepaesthetic.com SOA 86399 MNAME: ns1.kotuhost.com
RNAME: destek.labina.com.tr
Serial: 2015061800
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
onepaesthetic.com MX 14399 Target: onepaesthetic.com
onepaesthetic.com TXT 14399 TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all

Full WHOIS Lookup

Domain Name: ONEPAESTHETIC.COM
Registry Domain ID : 1439938428_DOMAIN_COM-VRSN
Registrar WHOIS Server : whois.nicproxy.com
Registrar URL: http://www.nicproxy.com
Updated Date: 2015-05-07T09:09:14Z
Creation Date: 2008-04-01T11:33:45Z
Registrar Registration Expiration Date: 2018-04-01T11:33:45Z
Registrar:NICS TELEKOMUNIKASYON TICARET LTD.STI.
Registrar IANA ID: 1454
Registrar Abuse Contact Email: abuse@nicproxy.com
Registrar Abuse Contact Phone: +90.2122132963
Reseller: NATRO COMMUNICATION LTD.
Domain Status: ok http://www.icann.org/epp#OK
Registry Registrant ID: CID-152676ONE
Registrant Name: Onur Erol
Registrant Organization: Onur Erol
Registrant Street: Manolyali sok. No:15
Registrant City: istanbul
Registrant State / Province: Levent
Registrant Postal Code: 34330
Registrant Country: TR
Registrant Phone: 02122836378
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: baris.yardimoglu@beycon.com.tr
Registry Admin ID: CID-152676ONE
Admin Name: Onur Erol
Admin Organization: Onur Erol
Admin Street: Manolyali sok. No:15
Admin City: istanbul
Admin State / Province: Levent
Admin Postal Code: 34330
Admin Country: TR
Admin Phone: 02122836378
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: baris.yardimoglu@beycon.com.tr
Registry Tech ID: CID-152676ONE
Tech Name: Onur Erol
Tech Organization: Onur Erol
Tech Street: Manolyali sok. No:15
Tech City: istanbul
Tech State / Province: Levent
Tech Postal Code: 34330
Tech Country: TR
Tech Phone: 02122836378
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: baris.yardimoglu@beycon.com.tr
Name Server: NS1.KOTUHOST.COM
Name Server: NS2.KOTUHOST.COM
DNSSEC: Unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>>Last update of WHOIS database: 2017-07-14T21:24:56Z

🚀 FREE! Get $200 in credit for VPS, Object Storage, Databases, Serverless Computing, and more!

Sign up now and instantly receive your $200 credit.

Start building your dream projects today! 🌟

Top Websites • CuteStat Lite Tutorials • What is My IP • CuteStat Bot • Update or Remove • Terms & Conditions • Privacy Policy • Customer Login • Contact Us
Copyright © 2009 - 2024 CuteStat, All Rights Reserved.
Any other brand information used from us are the properties of their respective owners.